<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F64950 F64950 U.K. 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 68
2 3TC+AZT+NFV 15
3 3TC+AZT+NVP 118

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KN, G190GA   V35T, E36A, T39E, S48T, E53D, K101X, K122E, D123S, E138A, K173T, Q174K, T200A, E203A, Q207E, R211K, F214L, V245Q, E248N, D250E, A272P, K275R, Q278H, E291D, V292I, I293V, V317A, I329V I135LP
>F64950| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLXKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYVDDLYVASDLEIGQHRAKIAELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, D60E, L63LP, H69K, L89IM, I93L  
>F64950| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNILTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005