<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M76115 M76115 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ NVP 130
2 LPV+ AZT+ 3TC+ ABC+ TDF 19

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F116Y G190A   E6K, V35T, T39A, K122E, D123S, E169D, Q174K, D177E, V179I, Q207A, R211S, H221Y, V245T, K277R, K281R, L283I, E291D, I293V, P294T F87S
>M76115| codons 1-296
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDSWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILDPFRKKNPEIII
YQYMDDLYVASDLEIGQHRTKIEELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCRLIRGTKALTDVVTLT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, N37E, R41K, K45R, R57K, H69K, L89M  
>M76115| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDIELPGKWKPRMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005