<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M62717 M62717 U.K. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 54
2 IDV+ 3TC+ D4T 49
3 3TC+ D4T+ NVP+ SQV+ RTV 66
4 ABC+ DDI+ D4T 110
5 3TC+ ABC+ LPV 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67HN, K70R, L74V, M184V, T215F K219E K103N   I5IV, V35T, K43R, I50V, A98S, K122E, D123S, P170PS, Q174QR, D177DN, Y181X, R211K, F214FL, D218E, A272P, K277R, V292I, E297K, I326IL, I329IL  
>M62717| codons 1-335
PISPVETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEREGKISKVGPENPYNTPV
FAIKKKHSTRWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILESFRKRNPNIVI
XQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLFTPEEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLLAELQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M   I13AV, K14R, I15IV, K20IV, L24X, E35D, M36I, N37D, R41K, K45V, L63LP, I64IV, H69K, V82I, L89I, Q92QK  
>M62717| codons 1-99
PQITLWQRPLVTARVGGQLIEALXDTGADDTVLEDIDLPGKWKPVMIGGIGGFVKVRQYD
QIPVEICGKKAIGTVLVGPTPINVIGRNIMTKIGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005