<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F54577 F54577 U.K. 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 94
2 3TC+ AZT+ NVP 168

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>F54577| codons 1-99
PQITLWQRPLVTVRVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215V, K219Q K101E, G190A   V35T, T39A, E40D, V60I, D121H, K122E, D123G, I135T, K173S, Q174K, D177E, V179I, G196E, T200A, Q207A, R211N, V245Q, K281R, T286A, E291D, V292I, I293V, P294T, E312S  
>F54577| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYVDDLYVASDLEIEQHRAKIEELRAHLLNWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKSPVHGVYYDPSKD

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005