<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F77878 F77878 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 Unknown 4
3 3TC+D4T+NFV 133

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   G17D, K20R, E35D, M36I, L63Q, I64V, H69K, L89M, I93L  
>F77878| codons 1-99
PQITLWQRPLVTIKIGDQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIQVEICGKKAIGTVLVGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y   K101P, K103N   P4S, E28K, V35T, T39E, S48T, V60I, K102R, K122E, K173A, D177E, I178L, T200A, E204K, Q207E, R211K, I244V, V245Q, L246LM, A272P, T286A, E291D, V292I, I293V Y183N, D218DY, H221HP
>F77878| codons 1-333
PISSIETVPVKLKPGMDGPKVKQWPLTKEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPRNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPELVI
YQNMDDLYVGSDLEIGQHRAKIEKLREHLLKWGFYTPYKKPQKEPPFLWMGYELHPDKWT
VQPVQMPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005