<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F76135 F76135 U.K. 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ RTV+ EFV+ ABC 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q K103N   V35T, S48T, V60I, K122E, I135T, K173V, Q174K, D177E, I178M, Q207A, R211S, D218DE, K238KQ, V245E, D250E, K281R, T286A, E291D, I293V, P294T  
>F76135| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRVKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPEQKHQKEPPFLWMGYELHPDQWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q7QH, T12V, K14R, K20R, E21K, E35D, M36I, N37D, R41K, R57K, L63V, H69K, L89M  
>F76135| codons 1-99
PQITLWHRPLVVIRIGGQLRKALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005