<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F75698 F75698 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI+ D4T 39
2 3TC+ AZT+ NVP+ ABC 110

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, R41K, L63Q, I64V  
>F75698| codons 1-92
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, M184V, T215FY   Y181V   K22KN, V35T, K49KR, V60I, V90VI, K122E, D123NS, I135T, K173S, Q174K, V179I, Q207E, R211S, H221Y, V245Q, D250E, T286A, E291D, V292I, I293V, E312DG, Q334QH R72RK
>F75698| codons 1-334
PISPIETVPVKLKPGMDGPKVNQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWKKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAFFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPDIII
VQYVDDLYVGSDLEIGQHRTKIEELREHLLSWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKGPVHGVYYDPSKDLIAEIQKQGH

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005