<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-7920 7920-1697 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ IDV 16
2 3TC+ IDV 5
3 IDV 1
4 DDI+ NFV+ NVP 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I64V, T74A, Q92H  
>7920-1697| codons 1-95
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGAVLVGPTPVNIIGRNLLTHIGC

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   D123E, Q269X, A272P  
>7920-1697| codons 22-273
KQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTK
IEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLV
GKLNWASHIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005