<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-7873 7873-3061 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ D4T 1
2 3TC+ D4T 11
3 IDV 12
4 IDV+ D4T+ 3TC 11
5 D4T+ 3TC 42
6 D4T+ 3TC+ IDV 34
7 3TC+ IDV 9
8 3TC+ IDV+ D4T 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, V82A   L63P, A71V  
>7873-3061| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEEMNLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39A, K104KT, A158S, P176S  
>7873-3061| codons 23-260
QWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNK
RTQDFWEVQLGIPHPAGLKKKTSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGI
RYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNSDIVIYQYVDDLYVGSDLEIGQHRTKI
EELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005