<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-7353 7353-2381 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ D4T 1
2 D4T 1
3 D4T+ NFV 4
4 D4T+ NFV+ DLV 91

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   E35D, M36V, N37H, R41K, L63P, I64V, K70R, V77I  
>7353-2381| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEDVHLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   Y181C   S68G, K102E, A158S  
>7353-2381| codons 41-263
MEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KEKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIF
QSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKK
HQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005