<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-6089 6089-4951 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ IDV 7
2 IDV 11
3 IDV+ 3TC 179
4 IDV+ 3TC+ DDI 13
5 3TC 1
6 3TC+ APV 33
7 3TC 11

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       S68G  
>6089-4951| codons 34-80
LVEICTELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFREL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L L10LF R57K, I62V, L63P, A71T, I85V  
>6089-4951| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFLKVKQYD
QVPIEICGHKTIGTVLVGPTPVNIVGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005