<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5944 5944-4336 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 159

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V   L10R, I13V, Q18QH, K20T, Q61E, I64V, I66F, H69R, V77I  
>5944-4336| codons 1-93
PQITLWQRPRVTVKIGGHLTEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
EILVEFCGRKAIGTVLIGPTPVNVIGRNLLTQI

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005