<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5573 5573-2632 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 NFV 10
3 NFV+ 3TC+ D4T 27
4 NFV+ 3TC+ AZT 72
5 3TC+AZT+NFV 8
6 3TC+AZT+NVP 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, L63H  
>5573-2632| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIHIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62AV K103N   V90VI, K122E, I135T, S162C, Q174K, R211KT, V245E, A272P  
>5573-2632| codons 23-273
QWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNK
RTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGI
RYQYNVLPQGWKGSPAIFQCSMTKILEPFRKKNPDIVIYQYVDDLYVGSDLEIGQHRTKI
EELRQHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQKLVG
KLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005