<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5573 5573-2100 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 NFV 10
3 NFV+ 3TC+ D4T 27
4 NFV+ 3TC+ AZT 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I N88D L10V, I13V, I15V, L63A, F99X  
>5573-2100| codons 1-99
PQITLWQRPVVTVKVGGQLKEALLDTGADNTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNL

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005