<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-4670 4670-2557 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ 3TC+ SQV+ D4T 23
2 Unknown 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L33V, N37C, I64V, I93L, C95X  
>4670-2557| codons 1-99
PQITLWQRPLVSIKIGGQLKEALLDTGADDTVVEEMCLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGWTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V60I, I135L, S162H, R211K, V245K  
>4670-2557| codons 41-270
MEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIF
QHSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKK
HQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQKLVGKLNWASQI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005