<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3496 3496-2173 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 4
2 D4T+ 3TC 23
3 NVP+ DDI+ NFV 28
4 DDI+ NFV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74I, M184V, T215F K219Q G190A   D123E, S162D, I178M, V179I, Q207E, F214L, V245K, L260I  
>3496-2173| codons 31-260
IKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKIVDFRELNKRTQDFWEV
QLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLP
QGWKGSPAIFQDSMTKILEPFRKQNPDMIIYQYVDDLYVASDLEIGQHRTKIEELREHLL
RWGLFTPDQKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQKI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, I54IL N88D N37S, R41RK, L63P, I64IL W6W*
>3496-2173| codons 1-99
PQITL*QRPLVTIKIGGQLKEALLDTGADNTVLEEMSLPGKWKPKMIGGIGGFLKVRQYD
QIPLEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005