<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-1133 1133-4246 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC 1
2 IDV+ 3TC+ D4T 105
3 ABC+ APV+ DDI 33
4 ABC+ APV+ DDI+ RTV 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V       R83K, K173R, Q174K, Q207E, R211K, I257L  
>1133-4246| codons 21-260
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFREL
NKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPDIVIYQYVDDLYVGSDLEIGQHRT
KIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDLQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IM   L10I, N37D, K43R, L63P, V77I  
>1133-4246| codons 1-91
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWRPKIIGGIGGFMKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005