<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0045 0045-3869 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 9
2 3TC 3
3 3TC+ IDV+ D4T 94
4 3TC+ D4T 1
5 3TC+ D4T+ NFV 66

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   T12P, I13V, M36I, L63P, A71V  
>0045-3869| codons 1-92
PQITLWQRPLVPVKIGGQLKEALLDTGADNTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRNLLTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E40ED, V60I, R83K, D123E, I135T, D177E, V245K  
>0045-3869| codons 21-260
VKQWPLTEEKIKALVEICTDMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFREL
NKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRT
KIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005