<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HMDR-3 3-197C U.S. 1997 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 86
3 SQV 25
4 3TC+AZT+DDI 43
5 3TC+D4T+IDV 21
6 RTV+SQV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, G16A, R41K, Q61H, I62V, L63Q, A71V, T74A, V77I, I93L  
>3-197C| codons 1-99
PQITLWQRPIVTIKIAGQLKEALLDTGADDTVLEEMNLPGKWKPKMIVGIGGFTKVRQYD
HVQIEICGHKVIGAVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N     V35I, K43N, V60I, A98S, V118I, K122E, I135V, G196GE, Q207E, R211K E40E*DY
>3-197C| codons 26-245
LTEEKIKALIEICTYLENEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQ
DFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEEL
REHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWTVQPIV

References
Author Title Citation
Palmer, S Highly drug-resistant HIV-1 clinical isolates are cross-resistant to many antiretroviral compounds in current clinical development. AIDS, 1999
Shafer, RW Multiple concurrent reverse transcriptase and protease mutations and multidrug resistance of HIV-1 isolates from heavily treated patients. Ann Intern Med, 1998
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005