<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
H00ZM4746 H00ZM4746 Zambia 2000 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19I, E35D, M36I, N37D, L63A, H69K, L89M, I93L  
>H00ZM4746| codons 1-99
PQITLWQRPLVSIKVEGQIKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48P, K122E, T165I, K173A, D177E, I178M, T200A, E204K, Q207D  
>H00ZM4746| codons 41-240
MEKEGKIPKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMIKILEPFRAQNPEMVIYQYMDDLYVGSDLEIGQHRAKIEKLRDHLLRWGFTTPDKK
HQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Handema, R Prevalence of drug-resistance-associated mutations in antiretroviral drug-naive Zambians infected with subtype C HIV-1. ARHR, 2002