<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RO-BCI8 RO-BCI8 Romania 1994 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, E40D, T69I, D123E, I135L, S162Y, K173T, Q174K, P176Q, E194K, I195L, G196E, T200A, Q207A, R211K  
>RO-BCI8| codons 33-235
ALTEICADMEKEGKISKIGPENPYNTPVFAIKKKDSIKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQG
WKGSPAIFQYSMTKILEPFRTKNQDIVIYQYMDDLYVGSDLKLEQHRAKIEELRAHLLKW
GFTTPDKKHQKEPPFLWMGYELH

References
Author Title Citation
Apetrei, C Human immunodeficiency virus type 1 subtype F reverse transcriptase sequence and drug susceptibility. J Virol, 1998