<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG11353 RenG11353 Brazil 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50L G73S L10I, K14R, I15V, K20R, E35D, M36I, N37D, K45R, H69K, A71V, I85V  
>RenG11353| codons 4-99
TLWQRPIVTIRVGGQLREALLDTGADDTVLEDIDLPGRWKPRMIGGLGGFIKVRQYDQIL
IEICGKKVISTVLVGPTPVNIVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     I47IM, V60I, T69N, A98S, K122KE, I135L, S162Y, I178F, G196E K49K*, N57ND
>RenG11353| codons 38-247
CTEMEKEGKMS*IGPENPYDTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDFVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015