<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99ZACM9 99ZACM9 South Africa 1999 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, H69K, T74A, L89M, I93L  
>99ZACM9| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123N, K173T, G196K, T200A, Q207E, R211K, V245Q, A272H, K277R, T286V, E291D, V292I, I293V, Q334N, G335D, R356K, G359T, T377M, K390R, A400T, E404D, E432D, V435A, A437V, L452K, R461K, V466I, D471E, T477A, H483Q, L491P, S519N, K527N, K530R, V531I, A534S, A554S  
>99ZACM9| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIVI
YQYMDDLYVGSDLEIKQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYHGIKVRQLCKLLRGVKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGVETFYVDGAANRETKKGKAGYVTDKGRQKIVSLTETTNQKAELQ
AIQLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLINKERIYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, I84V, F100Y, L101I, T112V, T125A, K136Q, V201I, T218I, L234I, A265V S283G
>99ZACM9| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYVEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGSN
FTSTAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Papathanasopoulos, MA Full-length genome analysis of HIV-1 subtype C utilizing CXCR4 and intersubtype recombinants isolated in South Africa. ARHR, 2002