<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG11452 RenG11452 Brazil 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M Q58E, G73S L10I, I13M, I15V, L19LP, K20KI, L33L_L, M36V, K55KR, R57RK, I62V, L63P, H69K, A71V, V77VI, I85V Q7QP, L97L*
>RenG11452| codons 4-99
TLWPRPIVTMKVGGQPIEALLDTGADDTVLEEVNLPGRWKPKIIGGIGGFVRVKEYDQVP
IEICGKKVISTVLIGPTPANIVGRNLMTQIGCT*NF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N, Y188L   T39TA, S68G, K122E, S134SC, I135T, K166KR, V179IT, G196E, I202V P157PS
>RenG11452| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPCTNNETPGIRYQYNVLPQGWKGSS
AIFQSSMTRILEPFRKQNPDITIYQYVDDLLVGSDLEIEQHRTKVEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015