<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00BW1686 00BW1686 Botswana 2000 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19V, M36I, N37S, R41K, L63S, H69K, K70R, L89M, I93L  
>00BW1686| codons 1-99
PQITLWQRPLVTIKVGGQVKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123S, I135R, S163T, K173A, D177E, T200A, Q207D, R211K, P243T, V245Q, E248T, D250E, A272S, E291D, V292I, I293V, Q334H, G335D, R356K, G359T, K366R, T377M, I380V, K390R, A400T, T403A, E404D, L452A, V467I, L469I, D471E, H483Q, L491S, S519N, K527N, K530R, A534S, A554N  
>00BW1686| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPTKESWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLTEAVQKIAMESVVIWGKTPKFRLPIQKETWETWWADYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKAGKAGYVTDRGRQKVISITETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLINKERVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, M50I, I72V, F100Y, L101I, T112I, T124A, T125A, K136Q, L172H, I182V, V201I, L234I, D278A S283G
>00BW1686| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKIIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHHKTAVQMAV
FVHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGADCVAGRQDED

References
Author Title Citation
Novitsky, V Human immunodeficiency virus type 1 subtype C molecular phylogeny: consensus sequence for an AIDS vaccine design? J Virol, 2002