<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00BW3886 00BW3886 Botswana 2000 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36L, N37S, R41K, L63P, H69K, L89M, I93L T26I
>00BW3886| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDIGADDTVLEELSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123S, I135T, S162C, K173A, D177E, T200A, Q207E, R211K, V245Q, A272T, K277R, T286A, E291D, V292I, I293V, E312G, R356K, G359T, T377M, K390R, A400I, E404D, W426R, V435A, A437V, L452V, V467I, S468T, D471E, T477A, H483Q, L491S, V493A, S519N, K530G, A534S, A554K  
>00BW3886| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYTGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKGPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWEIWWTDYWQATWIPEWEFVNTP
PLVKLRYQLEKEPIAGVETFYVDGAANRETKVGKAGYVTDRGRQKVITLTETTNQKAELQ
AIQLALQDSGSEANIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEGVYLSWVPAHK
GIGGNEQVDKLVSKGIRKVL

References
Author Title Citation
Novitsky, V Human immunodeficiency virus type 1 subtype C molecular phylogeny: consensus sequence for an AIDS vaccine design? J Virol, 2002