<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA84_DR29 SA84_DR29 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, E35D, M36I, R41K, R57K, H69K, T74S, L89M, I93L  
>SA84_DR29| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q K103N, G190A   V35T, E36A, T39E, S48T, V60I, K122E, D123G, V148VG, K173A, D177E, T200A, E203Q, Q207E, H221Y, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, V317A  
>SA84_DR29| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNGLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVASDLEIGQHRAKIQELREHLLRWGFTTPDQKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005