<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA82_DR27 SA82_DR27 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41*LQ, M184V, T215Y   P236L A98G V35T, E36A, T39K, K43E, K122E, D123G, I135L, K173A, Q174K, D177E, T200A, Q207D, R211K, V245Q, E248D, A272P, K277R, K281R, T286A, E291D, V292I  
>SA82_DR27| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICKEQEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFYTPDKKHQKEPPFLWMGYELHLDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGAKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14N, I15V, L19T, N37NS, R41K, Q61QH, L63P, H69K, K70R, L89M V77VA
>SA82_DR27| codons 1-99
PQITLWQRPLVTINVGGQTKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
HIPIEICGKRAIGTVLAGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005