<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA82_DR27 SA82_DR27 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   P236L A98G V35T, E36A, T39K, M41X, K43E, K122E, D123G, I135L, K173A, Q174K, D177E, T200A, Q207D, R211K, V245Q, E248D, A272P, K277R, K281R, T286A, E291D, V292I  
>SA82_DR27| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICKEXEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFYTPDKKHQKEPPFLWMGYELHLDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGAKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14N, I15V, L19T, N37NS, R41K, Q61QH, L63P, H69K, K70R, L89M V77VA
>SA82_DR27| codons 1-99
PQITLWQRPLVTINVGGQTKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
HIPIEICGKRAIGTVLAGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005