<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG12200 RenG12200 Brazil 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54S, V82A L33F, K43T, N88ND L10I, I13V, K20T, M36I, D60E, Q61N, I62V, L63P, I66F, A71V, I72V, L89I, I93V  
>RenG12200| codons 4-99
TLWQRPIVTVKIGGQLTEALLDTGADDTVFEEINLPGRWTPKMIGGIGGFSKVRQYENVP
IEFCGHKVVGTVLVGPTPANIIGRDILTQVGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V T215V, K219Q K101E, G190S A98G T39A, V118I, D123N, I135T, E138A, K173Q, D177E, V179I, G196GR, T200A, F214L, V245K  
>RenG12200| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLEKKKSVTVLDVGDAYFSIPLDKNFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRQQNPEIIIYQYVDDLYVSSDLEIRQHRAKIEELRQHLLRWGLVTP
DQKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015