<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA75_DR16 SA75_DR16 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ ABC+ AZT+ 3TC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, V32VA, N88D I15IL, G16E, L19I, E35D, M36IV, R41K, Y59YF, Q61E, I62IV, H69K, T74S, L89M, I93L, N98K  
>SA75_DR16| codons 1-99
PQITLWQRPFVTIKLEGQIKEALLDTGADNTALEDINLPGKWKPKMIGGIGGFIKVRQFD
EVLIEICGKKAIGSVLVGPTPVNIIGRDMLTQLGCTLKF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215F     A98G V35T, T39E, E44D, S48T, E53D, V111I, V118VI, K122E, D123S, E138EA, K173A, Q174K, D177E, G196E, T200A, E203V, Q207E, H208Y, R211K, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V D121DG
>SA75_DR16| codons 1-310
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKDGKITKIGPDNPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDIGDAYFSIPL
GESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIEQHRAKIVELREYLWKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREIL

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005