<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR61 BR61 Brazil 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NFV 221

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, M36I, N37K, R41N, L63P, H69K, L89M, I93L  
>BR61| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35A, T39A, S48T, K122E, D123S, I135V, I142M, A158S, K173T, Q174K, D177E, I178M, T200A, I202V, Q207E, R211K, F214L  
>BR61| codons 1-231
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALAEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGMRYQYNVLPQGWKGSPSIFQSSMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDKKHQKEPPFLWMG

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006
Soares, EA Epidemiologic and molecular characterization of human immunodeficiency virus type 1 in southern Brazil. JAIDS, 2003