<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR60 BR60 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ IDV 154

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y K219Q   A98G V35T, T39L, V60I, I135T, I142V, S162Y, K173T, Q174K, T200A, Q207E, F214L  
>BR60| codons 1-222
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLYTPDQKHQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T L24I, T74P L10I, T12E, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, L89M  
>BR60| codons 1-99
PQITLWQRPIVEIKVGGQLREALIDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVKQYD
NVLIEICGHKAIGPVLVGPTPTNIIGRNMLTQIGCTLNF

References
Author Title Citation
Soares, EA Epidemiologic and molecular characterization of human immunodeficiency virus type 1 in southern Brazil. JAIDS, 2003
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006