<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR56 BR56 Brazil 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 91
2 AZT+ 3TC+ NFV 43
3 D4T+ DDI+ RTV 26
4 D4T+ 3TC+ NFV 104
5 AZT+ 3TC+ IDV+ RTV 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I50L, K101R, K122E, D123S, T200A, Q207E, R211K G51A
>BR56| codons 50-234
LAPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVL
DVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILE
PFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLW
MGYEL

References
Author Title Citation
Soares, EA Epidemiologic and molecular characterization of human immunodeficiency virus type 1 in southern Brazil. JAIDS, 2003
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006