<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1289 CA3211 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 4
2 D4T 17
3 3TC+D4T 9
4 3TC+D4T+SQV 48
5 3TC+D4T+NFV 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S, L90M K43T R57K, I62V, L63P, A71X  
>CA3211| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWTPKMIGGIGGFIKVKQYD
QVPIEICGHKXIGTVLVGPTPVNIIGRSLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, V35I, I135V, I142V, T165I, K201KI, K219X, K238KR E53E*, K220KN
>CA3210| codons 1-274
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGP*NPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTIIEELRQHLLRWGFTTPDXNHQKEPPFLWMGYELHPDRWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999