Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| BR53 | BR53 | Brazil | 2002 | HIV1 | F | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ 3TC | 8 |
| 2 | AZT+ 3TC+ RTV | 60 |
| 3 | AZT+ 3TC+ NVP | 43 |
| 4 | AZT+ 3TC+ IDV+ RTV | 91 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A | L10I, E35D, M36I, R41K, R57K, D60E, Q61N, L63P, I72R |
| >BR53| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYE NIPIEICGHKARGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Soares, EA | Epidemiologic and molecular characterization of human immunodeficiency virus type 1 in southern Brazil. | JAIDS, 2003 |
| Santos, AF | Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. | AIDS, 2006 |