<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA629 CA3205 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 52
2 AZT+SQV 313
3 3TC+AZT+IDV 113
4 3TC+D4T+NFV 4
5 AZT+DDI+RTV+SQV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q     V35I, K122E, I180V, H208Y, D218E, L228H, A272P, K277T, I293V  
>CA3205| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVV
YQYVDDLYVGSDLEIGQHRTKIEELRQYLLRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVTQLCKLLRGTKALTEVVPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M F53L, G73S L10I, L63P, C67F, H69HQ, A71V, V77I  
>CA3206| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLIKVRQYD
QIPIEIFGQKVISTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005