<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG13009 RenG13009 Brazil 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V V11VI, L33F, Q58E L10I, T12P, G16E, L19IT, K20T, N37S, R41K, K55KR, D60K, Q61D, L63N, V77L, I93L T26TI, M36R
>RenG13009| codons 4-97
TLWQRPIIPIKIEGQTTEALLDIGADDTVFEERSLPGKWKPKMIGGIGGFVRVREYKDIN
IEICGHKAIGTVLLGPTPVNVIGRNLLTQLGCTL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       E42G, T69P, E79D, V118I, I135IT, I142V, E194PQ, G196E, Q207E, R211K, L228H, V245M S68I, P226Q
>RenG13009| codons 40-247
ELGKEGKISKIGPENPYNTPVFAIKKKDIPKWRKLVDFRDLNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLQIEQHRTKIEELREHLLKWGFYTPDK
KHQKEPQFHWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015