<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA626 CA3200 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 DDI 57
3 D4T 52
4 3TC+D4T 13
5 3TC+D4T+SQV 43
6 3TC+D4T+NFV 11

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, Q151M, M184V D67G, F77L, F116Y     I31X, S68N, Q207E, F214L, T286A  
>CA3200| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKXKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGNTGWRKLVDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   N37S, R57K, L63P, A71T  
>CA3201| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005