<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA606 CA3198 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 209
2 DDI 82
3 D4T 39
4 3TC+AZT 17
5 3TC+AZT+SQV 9
6 3TC+AZT+IDV 57
7 3TC+D4T+RTV+SQV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, K20IM, N37ND, I62V, L63P, K70R, A71AITV, I72IL  
>CA3198| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHRVLSTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K20R, A98S, K102KR, K122E, A158S, Q197E, L228LH, V245X, A272P, L283I, I293V  
>CA3199| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKRKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGEHRTKIEELRQHLLRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIXLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005