<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA622 CA3191 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 18
2 AZT+DDC 4
3 AZT+DDI 13
4 3TC+AZT 44
5 3TC+D4T+IDV 22
6 D4T+DDI+IDV 32
7 3TC+D4T+RTV+SQV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, L90M G73S L10I, R41K, K45R, L63P, A71V, V77I, I85V, I93L  
>CA3191| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPRIIGGIGGFIKVRQYD
QIPIEICGHKVISTVLIGPTPTNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67NT, K70R, M184MV, L210W, T215Y V75VA, K219E     M16ML, V35I, E44D, A62AP, K64KR, L109LI, V118I, K122E, V179VI, I202V, H208Y, R211K, L228H, I257L N81NT, V90VA
>CA3190| codons 1-287
PISPIETVPVKLKPGLDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FPIRKKTSTRWRKLADFRELTKRTQDFWEAQLGIPHPAGLKKKKSVTVIDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKVEELRQYLWKWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQIYAGIKVKQLCKLLRGTK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005