<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG13066 RenG13066 Brazil 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82A L33F, F53L, G73GS, N88ND L10V, I13V, I15V, G16A, Q18I, K20T, M36I, N37E, K55R, R57K, Q61QDEH, I62IV, L63PT, I64ILM, T74S, V77I, L89MT E35S
>RenG13066| codons 4-99
TLWQRPVVTVKVAGILTEALLDTGADDTIFESIELPGRWKPKIVGGIGGLLRVKQYDHVT
MEICGHKAISSVLIGPTPANIIGRDTLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215Y K219EQ K103KN, Y188FL   T39A, K102KM, V106VI, V118I, K122E, D123E, I135T, V189VI, F214L, E224ED, L228H R78RK
>RenG13066| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFKELNKRTQDFWEVQLGIPHP
AGLKMNKSITVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLLIGSDLEIGQHRTKIEELRQHLLRWGLYTP
DQKHQKDPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015