<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA642 CA3186 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 52
2 3TC+D4T 52
3 3TC+D4T+SQV 48
4 3TC+D4T+NFV 22
5 3TC+D4T+IDV+NVP 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q V106VA, G190GA   A33AP, K43KE, S48SP, K122X, D123E, S162A, D177E, V179I, G196X, R211Q, D218E, A272P, K277R I37IT
>CA3186| codons 1-278
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKPLVETCTELEEEGKIPKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DXEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIII
YQYVDDLYVASDLEIXQHRTKIEELRQHLLQWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S N37D, R57K, D60E, L63P, A71V, I93L  
>CA3187| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVKQYE
QIPIEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Lawrence, J Clinical resistance patterns and responses to two sequential protease inhibitor regimens in saquinavir and reverse transcriptase inhibitor-experienced persons. J Infect Dis, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005