<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA794 CA3181 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 DDI 43
3 DDC 13
4 D4T 30
5 AZT+D4T 18
6 3TC+AZT+IDV 52
7 D4T+DDI+NVP 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, I62V, L63P, A71V  
>CA3181| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75IT, Q151QKLM, L210W, T215Y A62AV, K219KN Y181CS   K20R, V21I, V35I, K43Q, E79D, R83K, K122E, L187LF, G196E, Q197K, D218E, A272P, K277R N137NT
>CA3180| codons 1-288
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FVIKKKNSTKWRKLTDFRDLNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINTETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
SQYMDDFYVGSDLEIEKHRTKIEELRQHLWRWGFYTPENKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKA

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005