<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1171 CA3179 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 13
2 3TC+AZT+SQV 35
3 3TC+AZT+NFV+NVP 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I15V, M36I, L63C, A71V, I93L  
>CA3179| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QICIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   E6D, R83K, K102Q, K122E, S162A, I178L, Q207E, R211K, A272P, K277R, I293V  
>CA3178| codons 1-298
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005