<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA605 CA3175 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 330
2 3TC+AZT 22
3 3TC+AZT+IDV 35
4 3TC+D4T+IDV 13
5 3TC+D4T+IDV+NVP 17
6 3TC+D4T+RTV+SQV 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, M184V, L210W, T215F K219Q Y181C   K20R, K43KE, V60I, D121Y, K122E, I135M, S162F, D177E, G196E, H208Y, R211K, D218DE, L228H  
>CA3175| codons 1-277
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73CS L10I, L63P, V77I, I93L  
>CA3176| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAICTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005