<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA605 CA3174 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 330
2 3TC+AZT 22
3 3TC+AZT+IDV 35
4 3TC+D4T+IDV 13
5 3TC+D4T+IDV+NVP 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, V82F, L90M   L10I, L63P, I93L  
>CA3174| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, L210W, T215F V75M, K219Q K103N   K20R, K43KE, V60I, D121HY, K122E, I135M, S162F, E169ED, D177E, G196E, H208Y, R211K, L228H, V245VE  
>CA3173| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEA

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005