<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1.0278 1.0278 Kenya 2006 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39M, K49R, V60I, D121Y, K122E, D123E, I135IT, K173S, Q174K, D177E, V179I, I195L, T200I, Q207E, R211K, V245I, D250E, L282C, L283I, R284K, I293V, D324E A98Q
>1.0278| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPQGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYVDDLYVGSDLELGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKCIKGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, L19V, E35D, M36I, R41K, R57K, Q58QR, L63A, H69K, L89M  
>1.0278| codons 1-99
PQITLWQRPLVSVKIGGQVKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKRYD
QIAIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Inzaule, SC Prevalence and dynamics of the K65R drug resistance mutation in HIV-1-infected infants exposed to maternal therapy with lamivudine, zidovudine and either nevirapine or nelfinavir in breast milk. J Antimicrob Chemother, 2016