<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KSI 95KSI12 Korea 1995 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 AZT 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  M184T   V108I V35M, D123E, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E  
>95KSI12| codons 32-220
KALMEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQ
LGIPHPAGLKKKKSVTILDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQ
GWKGSPAIFQASMTKILEPFRTKNPEMVIYQYTDDLYVGSDLEIGQHRAKIEELREHLLR
WGFTTPDKK

References
Author Title Citation
Cho, YK Frequency of mutations conferring resistance to nucleoside reverse transcriptase inhibitors in human immunodeficiency virus type 1-infected patients in Korea. J Clin Microbiol, 2002