<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NYR 00NYR1 Korea 2000 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 AZT 108
2 AZT+ 3TC 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, V90I, K102Q, K122E, I135T, S162A, K173T, Q174K, D177E, I178M, T200A, Q207H, R211K  
>00NYR1| codons 30-230
KIKALTDICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
IQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQASMTKILEPFRTKNPEMVIYQYMDDLYVGSDLEIGQHRAKIEELRHHL
LKWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Cho, YK Frequency of mutations conferring resistance to nucleoside reverse transcriptase inhibitors in human immunodeficiency virus type 1-infected patients in Korea. J Clin Microbiol, 2002