<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KKS 99KKS12 Korea 1999 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT 347

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     T69N, K103R, K122E, T200I, I202V  
>99KKS12| codons 30-230
KIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRIKVEELRQHL
LRWGFTTPDQKHQKEPPFLWM

References
Author Title Citation
Cho, YK Frequency of mutations conferring resistance to nucleoside reverse transcriptase inhibitors in human immunodeficiency virus type 1-infected patients in Korea. J Clin Microbiol, 2002
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005